PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10027197
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 238aa    MW: 27303.7 Da    PI: 6.9864
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10027197genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv+ +  +G  +W+++++  g++R++k+c++rw +yl
      Lus10027197 14 KGPWTAEEDRKLVNFIVTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding49.31.1e-1569111347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         + E+ + +d++ +lG++ W++Ia++++ gRt++++k++w+++
      Lus10027197  69 VLNESEERIVIDLHSRLGNR-WSKIAAELP-GRTDNEIKNHWNTH 111
                      55689***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-22562IPR009057Homeodomain-like
PROSITE profilePS5129415.348961IPR017930Myb domain
SuperFamilySSF466892.01E-2711108IPR009057Homeodomain-like
SMARTSM007175.0E-141363IPR001005SANT/Myb domain
PfamPF002492.4E-151461IPR001005SANT/Myb domain
CDDcd001675.94E-101661No hitNo description
PROSITE profilePS5129425.70562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2363117IPR009057Homeodomain-like
SMARTSM007171.3E-1466114IPR001005SANT/Myb domain
PfamPF002499.6E-1469111IPR001005SANT/Myb domain
CDDcd001671.57E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDRKLVNFIV THGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGVL NESEERIVID LHSRLGNRWS KIAAELPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPVTHKPLD DKAKETTAYD VDHHGPQRDS CISDNDSFDE FRQFESKSMS TLSWSSELLS  180
VDDHIDSTWR PWSDTEFKKE LGSVGDHHLD DHHFSLLNGF NGFGEIDLLS DMNEHIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015581058.15e-90PREDICTED: protein ODORANT1
SwissprotQ50EX64e-86ODO1_PETHY; Protein ODORANT1
TrEMBLA0A058ZY372e-89A0A058ZY37_EUCGR; Uncharacterized protein
TrEMBLA0A058ZYZ93e-90A0A058ZYZ9_EUCGR; Uncharacterized protein
STRINGVIT_16s0022g01210.t011e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.13e-84myb domain protein 20